SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005613 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005613
Domain Number 1 Region: 818-1092
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-68
Family Protein kinases, catalytic subunit 0.00000804
Further Details:      
 
Domain Number 2 Region: 521-786
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-40
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 3 Region: 374-477,512-536
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000128
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 4 Region: 268-362
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000455
Family Third domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005613   Gene: ENSGGOG00000005727   Transcript: ENSGGOT00000005758
Sequence length 1107
Comment pep:known_by_projection chromosome:gorGor3.1:19:18181039:18203190:-1 gene:ENSGGOG00000005727 transcript:ENSGGOT00000005758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQTP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLHENLGHGSFTKIYRGCRHE
VVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQEF
VHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGADG
SPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFSGV
TMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLIS
SDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYD
PLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVM
EYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAH
VKIADFGLAKLLPLDKDYYVVREPGQSPIFWWYAPESLSDNIFSRQSDVWSFGVVLYELF
TYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAPS
PQDRPSFSALGPQLDMLWSGRRGCETH
Download sequence
Identical sequences ENSGGOP00000005613 ENSGGOP00000005613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]