SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005614 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005614
Domain Number 1 Region: 494-826
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.96e-114
Family PDEase 0.000000271
Further Details:      
 
Domain Number 2 Region: 52-249
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-38
Family GAF domain 0.00025
Further Details:      
 
Domain Number 3 Region: 235-279,306-455
Classification Level Classification E-value
Superfamily GAF domain-like 4.32e-31
Family GAF domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005614   Gene: ENSGGOG00000005730   Transcript: ENSGGOT00000005759
Sequence length 854
Comment pep:known_by_projection chromosome:gorGor3.1:4:612736:658270:1 gene:ENSGGOG00000005730 transcript:ENSGGOT00000005759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDGCPLDCDSLRELCQVEESTALL
ELVQDMQESINMERVVFKVLRRLCTLLQADHCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVKDVAECPHFSSFADELTDYKTKNMLATPI
MNGKDVVAVIMAVNKLNGPFFTSEDEDVFLKYVNFATLYLKIYHLSYLHNCETRRGQVLL
WSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWPVLMGESQPY
SGPRTPDGREIVFYKVIDYILHGKEEIKVIPAPPADHWALASGLPSYVAESGFICNIMNA
SADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMES
LTQFLGWSVMNTDTYDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRVRLGKEPADC
DEDELGEILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEVL
VRFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDID
HRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHLM
DIAIIATDLALYFKKRAMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACDLS
AITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCT
FVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEKKEEERVAAKKVGTEIC
NGGPAPKSSTCCIL
Download sequence
Identical sequences ENSGGOP00000005614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]