SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005623 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005623
Domain Number 1 Region: 8-58
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000353
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 2 Region: 411-444
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000106
Family CCCH zinc finger 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005623   Gene: ENSGGOG00000005735   Transcript: ENSGGOT00000005769
Sequence length 1043
Comment pep:known_by_projection chromosome:gorGor3.1:1:153236209:153291006:-1 gene:ENSGGOG00000005735 transcript:ENSGGOT00000005769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQAPQWTDFLSCPICTQTFDETIRKPISLGCGHTVCKMCLNKLHRKACPFDQTTINTD
IELLPVNSALLQLVGAQVPEQQPITLCSGVEDTKHYEEAKKCVEELALYLKPLSSARGVG
LNSTTQSVLSRPMQRKLVTLVHCQLVEEEGRIRAMRAARSLGERTVTELILQHQNPQQLS
SNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKT
SIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAP
DQWSSLLYGDQSHKSHMQSIIDKLQTPASFAQSVQELTIALQRTGDPANLNRLRPHLELL
ANIDPSPDAPPPTWEQLENGLVAVRTVVHGLVDYIQNHSKKGADQQQPPQHSKYKTYMCR
DMKQRGGCPRGASCTFAHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDE
GAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPGKIDHLSSSAPGSPPDLL
ESVPKSISALPVNPHPIPPRGPADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAA
PPFEPAPYQQGMYYTPPPQCVSRFVRPPPSAPEPAPPYLDHYPPYLQERVVNSQYGTQPQ
QYPPIYPSHYDGRRVYPAPSYTREEIFRESPIPIEIPPAAVPSYVPESRERYQQIESYYP
VAPHPTQIRPSYLREPPYSRLPPPPQPHPSLDELHRRRKEIMAQLEERKVISPPPFAPSP
TLPPTFHPEENVESKGMRDQRLDLQRRAAETSDDDLIPFGDRPTVSRFGAISRTSKTIYQ
GAGPMQAMAPQGAPTKSINISDYSPYGTHGGWGASPYSPHQNIPSQGHFSERERISMSEV
ASHGKPLPSAEREQLRLELQQLNHQISQQTQLRGLEAVSNRLVLQREANALAGQSQPPPP
PPPKWPGMISSEQLSLELHQVEREIGKRTRELSMDVPNGSALTQENISLLSNKTSSLNLS
EDPEGGGDNNDSQRSGVTPSSAP
Download sequence
Identical sequences ENSGGOP00000005623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]