SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005640 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005640
Domain Number 1 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005640   Gene: ENSGGOG00000005760   Transcript: ENSGGOT00000005787
Sequence length 225
Comment pep:known_by_projection chromosome:gorGor3.1:17:8341580:8345085:-1 gene:ENSGGOG00000005760 transcript:ENSGGOT00000005787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFS
ALHGYLRPKPPRPKPVDPRPPAPRLSLDPAAPALGPALHQRPPVHQGPPSPRCAWSPSLC
SPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP
Download sequence
Identical sequences ENSGGOP00000005640 XP_018868618.1.27298 ENSGGOP00000005640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]