SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005674 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005674
Domain Number 1 Region: 98-419
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.31e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000348
Further Details:      
 
Domain Number 2 Region: 414-560
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.52e-29
Family Ricin B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005674   Gene: ENSGGOG00000005792   Transcript: ENSGGOT00000005823
Sequence length 565
Comment pep:known_by_projection chromosome:gorGor3.1:9:80919369:80963988:1 gene:ENSGGOG00000005792 transcript:ENSGGOT00000005823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRRGPRWPGPGPQRRGQSGPVPVLLGRGGNTALQFAAAGGHEPWCASCCARCSVKPQPLR
LSALGPGEAAGREELRLQEESVRLHQINIYLSDRISLHRRLPERWNPLCKEKKYDYDNLP
RTSVIIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSDREHLKERLANELSGLPK
VRLIRANKREGLVRARLLGASAARGDVLTFLDCHCECHEGWLEPLLQRIHEEESAVVCPV
IDVIDWNTFEYLGNSGEPQIGGFDWRLVFTWHTVPERERIRMRSPVDVIRSPTMAGGLFA
VSKKYFEYLGSYDTGMEVWGGENLEFSFRIWQCGGVLETHPCSHVGHVFPKQAPYSRNKA
LANSVRAAEVWMDEFKELYYHRNPRARLEPFGDVTERKQLRAKLQCKDFKWFLETVYPEL
HVPEDRPGFFGMLQNKGLTDYCFDYNPPDENQIVGHQVILYLCHGMGQNQFFEYTSQKEI
RYNTHQPEGCIAVEAGMDTLIMHLCEETAPENQKFVLQEDGSLFHEQSKKCVQAARKESS
DSFVPLLRDCTNSDHQKWFFKERML
Download sequence
Identical sequences ENSGGOP00000005674 ENSGGOP00000005674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]