SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005678 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005678
Domain Number 1 Region: 165-338
Classification Level Classification E-value
Superfamily E set domains 9.1e-34
Family Arrestin/Vps26-like 0.024
Further Details:      
 
Domain Number 2 Region: 8-163
Classification Level Classification E-value
Superfamily E set domains 3.36e-23
Family Arrestin/Vps26-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005678   Gene: ENSGGOG00000005798   Transcript: ENSGGOT00000005827
Sequence length 407
Comment pep:known_by_projection chromosome:gorGor3.1:19:18369935:18375997:1 gene:ENSGGOG00000005798 transcript:ENSGGOT00000005827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELASAARVGALRLRARGRAHVHWT
ESRSAGSSTAYTQSYSERVEVVSHRATLLAPDTGETTTLPPGRHEFLFSFQLPPTLVTSF
EGKHGSVRYCIKATLHRPWVPARRARKVFTVIEPVDINTPALLAPQAGAREKVARSWYCN
RGLVSLSAKIDRKGYTPGEVIPVFAEIDNGSTRPVLPRAAVVQTQTFMARGARKQKRAVV
ASLAGEPVGPGQRALWQGRALRIPPVGPSILHCRVLHVDYALKVCVDIPGTSKLLLELPL
VIGTIPLHPFGSRSSSVGSHASFLLDWRLGALPERPEAPPEYSEVVADTEEAALGQSPFP
LPQDPDMSLEGPFFTYIQEFRYRPPPLYSEEDPNPPLGDMRPRCMTC
Download sequence
Identical sequences G3QSN6
ENSGGOP00000005678 XP_004060336.1.27298 ENSGGOP00000005678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]