SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005688 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005688
Domain Number 1 Region: 329-604
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-79
Family Mitochondrial carrier 0.0000436
Further Details:      
 
Domain Number 2 Region: 11-157
Classification Level Classification E-value
Superfamily EF-hand 1.46e-19
Family Calbindin D9K 0.074
Further Details:      
 
Domain Number 3 Region: 159-278
Classification Level Classification E-value
Superfamily EF-hand 0.0000000286
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005688   Gene: ENSGGOG00000005803   Transcript: ENSGGOT00000005837
Sequence length 676
Comment pep:known_by_projection chromosome:gorGor3.1:7:93460211:93668586:-1 gene:ENSGGOG00000005803 transcript:ENSGGOT00000005837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQ
RSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKF
MHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGF
FGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVT
PADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLT
YELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLP
LFKPSVSTSKAIGGSP
Download sequence
Identical sequences ENSGGOP00000005688 ENSGGOP00000005688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]