SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005693 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005693
Domain Number 1 Region: 157-312
Classification Level Classification E-value
Superfamily EF-hand 1.3e-27
Family Calmodulin-like 0.016
Further Details:      
 
Domain Number 2 Region: 28-139
Classification Level Classification E-value
Superfamily EF-hand 1.32e-17
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005693   Gene: ENSGGOG00000005817   Transcript: ENSGGOT00000005842
Sequence length 318
Comment pep:known_by_projection chromosome:gorGor3.1:7:126857997:126893460:1 gene:ENSGGOG00000005817 transcript:ENSGGOT00000005842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIIMDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEE
AKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHD
LNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFT
AFLHPEEYDYMKDIVVQETVEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQF
VEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLF
VGSQATDFGEALVRHDEF
Download sequence
Identical sequences ENSGGOP00000005693 ENSGGOP00000005693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]