SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005694 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005694
Domain Number 1 Region: 51-376
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.25e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 382-515
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.57e-22
Family Ricin B-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005694   Gene: ENSGGOG00000005815   Transcript: ENSGGOT00000005843
Sequence length 518
Comment pep:known_by_projection chromosome:gorGor3.1:7:68355398:68787364:1 gene:ENSGGOG00000005815 transcript:ENSGGOT00000005843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSEKISLDRSIPDYRPT
KCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVDDNSDEEELK
VPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVEFTAGWAEPVL
SRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDPSLPI
RTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVLPCSRVAHIE
RKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDVSERRALRKS
LKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLDQGPLENHTAILYPCHGWGPQ
LARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDCDKVKSSLYKRWNFIQNGAI
MNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
Download sequence
Identical sequences ENSPTRP00000032916 ENSGGOP00000005694 ENSPTRP00000032916 ENSGGOP00000005694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]