SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005722 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005722
Domain Number 1 Region: 23-166
Classification Level Classification E-value
Superfamily C-type lectin-like 1.63e-32
Family C-type lectin domain 0.000000648
Further Details:      
 
Domain Number 2 Region: 243-308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 367-440
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000598
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 181-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000108
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 303-377
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000012
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 424-491
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000375
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 489-550
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000121
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005722   Gene: ENSGGOG00000005841   Transcript: ENSGGOT00000005871
Sequence length 611
Comment pep:known_by_projection chromosome:gorGor3.1:1:148928132:148940045:-1 gene:ENSGGOG00000005841 transcript:ENSGGOT00000005871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQFFSALTLVVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYL
NSILSYSPNYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRE
KDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVN
CTALESPEHGSLVCSHPLGNFSYNSSCSVSCDRGYLPSSMETMQCMSSGEWSAPIPACNV
VECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTC
KAVTCRAIRQPQNGSVRCSHSPAGEFSFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQI
PVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWD
NEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQG
QWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTECKFACPEGWTLNGSAALTCGATGH
WSGLLPTCEAPTEPNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLES
DGSYQKPSYIL
Download sequence
Identical sequences ENSGGOP00000005722 ENSGGOP00000005722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]