SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005782 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005782
Domain Number 1 Region: 706-854
Classification Level Classification E-value
Superfamily HAD-like 3.56e-20
Family phosphatase domain of polynucleotide kinase 0.05
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005782
Domain Number - Region: 671-721
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0288
Family WD40-repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005782   Gene: ENSGGOG00000005901   Transcript: ENSGGOT00000005934
Sequence length 930
Comment pep:known_by_projection chromosome:gorGor3.1:2a:12054510:12115602:1 gene:ENSGGOG00000005901 transcript:ENSGGOT00000005934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAQTMNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMG
VLRSREKVVDIEINGESVDLHMKLGDNGEAFFVQETDNDQEVIPMHLATSPILSEGASRM
ECQLKRGSVDRMRGLDPSTPAQVIAPSETPSSSSVVKKRRKRRRKSQLDSLKRDDSMNTS
EDEDMFPIEMSSDEAMELLESSRTLPNDIPPFQDDIPEENLSPAVIYPQSASYPNSDREW
SPTPSSLVDCKRTAPHLAVAAEGGLSSSCPPQSSLFHPSESPSGSRPSTPKSDSELVSKS
TDRTGQKNPEMLWLWGELPQAAKSSSPHKMKESSPLSSRKICDKSHFQAIHSESSDTFSD
QSPTLVGGALLDQNKPQTEMQFVNEEDLETLGAAAPLLPVIEELKPPSASVVQTANKTDS
PSRKKDKRSRHLGADGVYLDDLTDMDPEVAALYFPKNGDPSGLAKHAIDNGARSANQSPQ
SVGSSGVDSGVESTSDGLRDLPSIAISLCGGLSDHREITKDAFLEQAVSYQQFVDNPAII
DDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVESIMRDKMPKKGGRWWFSWRGR
NTTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSSSDEERAAAKPSNAGHLPLLP
NVSYKKTLRLTSEQLKSLKLKNGPNDVVFSVTTQYQGTCRCEGTIYLWNWDDKVIISDID
GTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFLYCSARAIGMADMTRGYLHWV
NERGTVLPQGPLLLSPSSLFSALHREVIEKKPEKFKVQCLTDIKNLFFPNTEPFYAAFGN
RPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYVRLCEVVDHVFPLLKRSHSSD
FPCSDTFSNFTFWREPLPPFENQDIHSASA
Download sequence
Identical sequences ENSGGOP00000005782 ENSGGOP00000005782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]