SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005786 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005786
Domain Number 1 Region: 181-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-42
Family SPRY domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005786   Gene: ENSGGOG00000005912   Transcript: ENSGGOT00000005939
Sequence length 360
Comment pep:known_by_projection chromosome:gorGor3.1:5:53259428:53284768:-1 gene:ENSGGOG00000005912 transcript:ENSGGOT00000005939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSLRSEAMRPMTLLLLVRVAVEKSIT
EVGQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSSGVDLSMASPKLVTSDT
AAGKIRDILHDLEEIQEKLQENVTRKEAPEAQMQGELLEAPSSSSCPLPDQSHPALRRAS
RFAQWAIRPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCERFSTSQVLCSQALSSGK
HYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQLSAWHMVKETVLGSDR
PGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWLYGLHPGNYLIIKQVKV
Download sequence
Identical sequences ENSGGOP00000005786 ENSGGOP00000005786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]