SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005789 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005789
Domain Number 1 Region: 202-352
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-45
Family Dual specificity phosphatase-like 0.00000344
Further Details:      
 
Domain Number 2 Region: 12-177
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.94e-25
Family Cell cycle control phosphatase, catalytic domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005789   Gene: ENSGGOG00000005916   Transcript: ENSGGOT00000005942
Sequence length 411
Comment pep:known_by_projection chromosome:gorGor3.1:8:29344455:29361384:-1 gene:ENSGGOG00000005916 transcript:ENSGGOT00000005942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVLFSSSRAQPPRFPATMVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGG
KCLLLDCRPFLAHSAGYIRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYS
AVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKA
LAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGIT
ALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAG
ISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEA
ASPSGPLRERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC
Download sequence
Identical sequences ENSGGOP00000005789 ENSGGOP00000005789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]