SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005820 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005820
Domain Number 1 Region: 964-1273
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.27e-91
Family Complement components 0.0000277
Further Details:      
 
Domain Number 2 Region: 1346-1477
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.67e-40
Family Alpha-macroglobulin receptor domain 0.000000789
Further Details:      
 
Domain Number 3 Region: 792-912
Classification Level Classification E-value
Superfamily E set domains 3.5e-35
Family SVA-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005820
Domain Number - Region: 360-419
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0118
Family Invasin/intimin cell-adhesion fragments 0.0092
Further Details:      
 
Domain Number - Region: 400-471
Classification Level Classification E-value
Superfamily ADC synthase 0.0183
Family ADC synthase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005820   Gene: ENSGGOG00000005938   Transcript: ENSGGOT00000005975
Sequence length 1482
Comment pep:known_by_projection chromosome:gorGor3.1:12:9385465:9444664:-1 gene:ENSGGOG00000005938 transcript:ENSGGOT00000005975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKDRLLHLCLVLLLILLSASDSNSAEPQYMVLVPSLLHTEAPKKGCVLLSHLNETVTVS
ASLESGRENRSLFTDLVAEKDLFHCVSFTLPRISASSEVAFLSIRIKGLTQDFRKRNTVL
VLNTQSLVFVQTDKPMYKPGQTVRFRVVSVDENFRPRNELIPLIYLENPRRNRIAQWQSL
KLEAGLNQLSFPLSSEPIQGSYRVVVQTESGGRIQHPFTVEEFVLPKFEVKVQVPKIISI
MDEKVNITVCGEYTYGKPVPGLATVSLCRKLSRVLNCDKQEVCEEFSQQLNSNGCITQQV
HTKMLQITNTGFEMKLRVEARIREEGTDLEVTANRISEITNIVSKLKFVKVDSHFRQGIP
FFAQVLLVDGKGVPIPNKLIFMSVNDANYYSNATTNEQGLAQFSINTTNISVNILFVRVF
TVHPNLCFHYSWVAEDHQGAQHTANRVFSLSGSYIHLEPVAGTLPCGHTETIMAHYTLNR
QAMGELSELSFHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFA
ILPDGEVVGDSEKFEIENCLANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSV
LLMKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAVYVPLSSNEA
DIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYN
VMPLSNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSE
DAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRVSVQLKASPAF
LASQNTKGEESYCICGNERQTLSWTVTPKTLGNVNFSVSAEAMQSLELCGNEVAEVPEIK
RKDTVIKTLLVEAEGIEQEKTFSSMTCASGADVSEQLSLKLPSNVVKESARASFSVLGDI
LGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQR
QLNYKHQDGSYSTFGERYGRNQGNTWLTAFVLKTFAQARSYIFIDEAHITQSLTWLSQMQ
KDNGCFRSSGSLLNNAIKGGVEDEATLSAYVTIALLEIPLPVTNPIVRNALFCLESAWNV
AKEGTHGSHVYTKALLAYAFSLLGKQNQNREILNSLDKEAVKEDNLVHWERPQRPKAPVG
HLYQPQAPSAEVEMTSYVLLAYLTAQPAPTSGDLTSATNIVKWIMKQQNAQGGFSSTQDT
VVALHALSRYGAATFTRTEKTAQVTVQDSQTFSTNFQVDNNNLLLLQQISLPELPGEYVI
TVTGERCVYLQTSMKYNILPEKEDSPFALKVQTVPQTCDGHKAHTSFQISLTISYTGNRP
ASNMVIVDVKMVSGFIPLKPTVKMLERTSSVSRTEVSNNHVLIYVEQVTNQTLSFSFMVL
QDIPVGDLKPAIVKVYDYYETDESVVAEYIAPCSTDTEHGNV
Download sequence
Identical sequences ENSGGOP00000005820 ENSGGOP00000005820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]