SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005833 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005833
Domain Number 1 Region: 78-202
Classification Level Classification E-value
Superfamily HSP20-like chaperones 7.5e-22
Family GS domain 0.012
Further Details:      
 
Domain Number 2 Region: 5-54
Classification Level Classification E-value
Superfamily Calcyclin-binding protein-like 1.24e-16
Family Siah interacting protein N terminal domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005833   Gene: ENSGGOG00000005962   Transcript: ENSGGOT00000005990
Sequence length 230
Comment pep:known_by_projection chromosome:gorGor3.1:1:154341190:154348643:1 gene:ENSGGOG00000005962 transcript:ENSGGOT00000005990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFVLTQLQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNE
KPAAVVAPITTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVK
NLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEK
PSYDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF
Download sequence
Identical sequences ENSGGOP00000005833 ENSGGOP00000005833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]