SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005835 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005835
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.17e-29
Family Ribosomal protein S14 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005835   Gene: ENSGGOG00000005966   Transcript: ENSGGOT00000005992
Sequence length 128
Comment pep:known_by_projection chromosome:gorGor3.1:1:154350662:154361937:-1 gene:ENSGGOG00000005966 transcript:ENSGGOT00000005992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKN
TILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQL
SGIQRATW
Download sequence
Identical sequences G3QT30 H2Q0N3 O60783
ENSP00000420714 ENSPTRP00000002839 ENSP00000420714 ENSGGOP00000005835 ENSP00000420714 ENSGGOP00000005835 NP_071383.1.87134 NP_071383.1.92137 XP_001152337.1.37143 XP_003824732.1.60992 XP_004027983.1.27298 3j9m_AK ENSPTRP00000002839 9598.ENSPTRP00000002839 9606.ENSP00000420714 gi|11559927|ref|NP_071383.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]