SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005854 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005854
Domain Number 1 Region: 7-84,178-248
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000792
Family Calmodulin-like 0.089
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005854
Domain Number - Region: 223-349
Classification Level Classification E-value
Superfamily EF-hand 0.0101
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005854   Gene: ENSGGOG00000005976   Transcript: ENSGGOT00000006011
Sequence length 2133
Comment pep:known_by_projection chromosome:gorGor3.1:14:31555625:31671628:-1 gene:ENSGGOG00000005976 transcript:ENSGGOT00000006011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLG
RVHFDQFKEALILILSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQESVEEF
PEVTVIEPLDEEARPSHIPASDCSEHWKTQRSEEYEAEGQLRFWNPDDLNASQSGSSPPQ
DWIEEKLQEVCEDLGITRDGHLNRKKLVSICEQYGLQNVDGEMLEEVFHNLDPDGTMSVE
DFFYGLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRTTTSSAMTSTIGFRVFSCLDD
GMGHASVERILDTWQEEGIENSQEILKALDFSLDGNINLTELTLALENELLVTKNSIHQA
ALASFKAEIRHLLERVDQVVREKEKLRSDLDKAEKLKSLMASEVDDHHAAIERRNEYNLR
KLDEEYKERIAALKNELRKEREQILQQAGKQRLELEQEIEKAKTEENYIRDRLALSLKEN
SRLENELLENAEKLAEYENLTNKLQRNLENVLAEKFGDLDPSSAEFFLQEERLTQMRNEY
ERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEELDANSGSIEPEHGLGSEECNP
LNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCEKAQENMKQRHEN
ETHTLEKQISDLKNEIAELQGQAALLKEAHHEATCRHEEEKKQLQVKLEEEKTHLQEKLR
LQHEMELKARLTQAQASFEREREGLQSSAWTEEKVRGLTQELEQFHQEQLTSLVEKHTLE
KEELRKELLEKHQRELQEGREKMETECNRRTSQIEAQFQSDCQKVTERCESALQSLEGRY
RQELKDLQEQQREEKSQWEFEKDELTQECAEAQELLKETLKREKTTSLVLTQEREMLEKT
YKEHLNSMVVERQQLLQDLEDLRNVSETQQSLLSDQILELKSSHKRELREREEVLCQAGA
SEQLASQRLERLEMEHDQERQEMMSKLLAMENIHKATCEKADRERAEMSTEISRLQSKIK
EMQQATSPLSVLQIGCQVIGEEEVEGDGALSLLQQGEQLLEENGDVLLSLQRAHEQAVKE
NVKMATEISRLQQRLQKLEPGLVMSSCLDEPATEFFGNTAEQTEPFLQQNRTKQVEGVTR
RHVLSDLEDEEVRDLGSTGTSSVQRQEVKIEESEASVEGFSELENSEETRTESWELKNQI
SQLQEQLMMLCADCDRASEKKQDLLFDVSVLKKKLKMLERIPEASPKYKLLYEDVSREND
CLQEELRMMETRYDEALENNKELTAEVFRLQDELKKMEEVTETFLSLEKSYDEVKIENEE
LNVLVLRLQGKIEKLQESVVQRCDCCLWEASLENLEIEPDGNILQLNQTLQECVPRVRSV
HHVIEECKQENQYLEGNTQLLEKVKAHEIAWLHGTIQTHQERPRVQNQVILEENTTLLGF
QDKHFQHQATIAELELEKTKLQELTRKLKERVTILVKQKDVLSHGEKEEELKAMMHDLQI
TCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSISNLKLGTLNGSQEEMWQKTET
VKQENAAVQKMVENLKKQISELKIKNQQLDLENTELSQKNSQNQEKLQELNQRLTEMLCQ
KEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAELSEFKIQTHIVQQENLLLK
DELEKMKQLHRCPDLSDFQQKISSVLSYNEKLLKEKEALSEELNSCVDKLAKSSLLEHRI
ATMKQEQKSWEHQSASLKSELVASQEKVQNLEDTLQNVNLQMSRMKSDLRVTQQEKEALK
QEVMSLHKQLQNAGGKSWAPEIATHPSGLQNQQKRLSWDKLDHLMNEEQQLLWQENERLQ
TVVQNTKAELTHSREKVRQLESNLLPKHQKHLNPSGTMKPTEQEKLSLKRECDQFQKEQS
PANRKVSQMNSLEQELETIHLENEGLKKKQVKLDEQLMEMQHLRSTATPSPSPHAWDLQL
LQQQACPMVPREQFLQLQHQLLQAERINQHLQEELENRTSETNTPQGNQEQLVTVMEERM
IEVEQKLKLVKSLLQEKVNQLKEQLCKNTKADAMVKDLYVENAQLLKALEVTEQRQKTAE
KKNYLLEEKIASLSNIVRNLTPAPLTSTPPLRS
Download sequence
Identical sequences ENSGGOP00000005854 ENSGGOP00000005854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]