SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005871 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005871
Domain Number 1 Region: 202-242
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000133
Family Erythroid transcription factor GATA-1 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005871   Gene: ENSGGOG00000006002   Transcript: ENSGGOT00000006028
Sequence length 271
Comment pep:known_by_projection chromosome:gorGor3.1:19:10502134:10507217:-1 gene:ENSGGOG00000006002 transcript:ENSGGOT00000006028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPQVGCVACPRVHKEPAQVGTPWPAKPRSHPRKRDPTALLPRSLWPACQDPVTALCFL
QETVERLGQSPAQDTPVLGPCWDPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGTPS
APPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQESPADA
VGGPAAHPGGTEAHSAGSEALEPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTR
CSSCWLVPRKNVQPKRLCGRCGVSLDPIQEG
Download sequence
Identical sequences G3QT61
XP_004060031.1.27298 ENSGGOP00000005871 ENSGGOP00000005871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]