SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005872 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005872
Domain Number 1 Region: 526-604
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000285
Family Canonical RBD 0.016
Further Details:      
 
Domain Number 2 Region: 884-954
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000011
Family Canonical RBD 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000005872
Domain Number - Region: 286-312
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000102
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 5-72
Classification Level Classification E-value
Superfamily PWI domain 0.00248
Family PWI domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005872   Gene: ENSGGOG00000005994   Transcript: ENSGGOT00000006029
Sequence length 974
Comment pep:known_by_projection chromosome:gorGor3.1:13:62152806:62237116:-1 gene:ENSGGOG00000005994 transcript:ENSGGOT00000006029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKE
TQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRL
NHSPPQSSSRYRENRSRDERKKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYSRSRS
RSWSKERLRERDRDRSRTRSRSRTRSRERDLVKPKYDLDRTDPLENNYTPVSSVPSISSG
HYPVPTLSSTITVIAPTHHGNNTTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDEKGFCM
RGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPV
PPPGPLPPSLPPVTGPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFT
ADTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSSMRIV
VDSESRKRTIGSGEPGVPTKKTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVPPELN
NISKLNEHFSRFGTLVNLQVAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWH
REGSTQQLQTTSPKVMQPLVQQPILPVVKQSVKERLGPVPSSTIEPAEAQSASSDLPQNV
TKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYNPAALKAAQKTLLVSTSAVDNNEAQ
KKKQEALKLQQDVRKRKQEILEKHIETQKMLISKLEKNKTMKSEDKAEIMKTLEVLTKNI
TKLKDEVKAASPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLE
AAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDRE
DLLPHFAQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNI
SAVETEEVEPDEEE
Download sequence
Identical sequences ENSGGOP00000005872 ENSGGOP00000005872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]