SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005897 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005897
Domain Number 1 Region: 209-298,420-523,975-1191
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.06e-38
Family Calcium ATPase, transmembrane domain M 0.038
Further Details:      
 
Domain Number 2 Region: 524-540,672-761,833-889
Classification Level Classification E-value
Superfamily HAD-like 1.8e-30
Family Meta-cation ATPase, catalytic domain P 0.019
Further Details:      
 
Domain Number 3 Region: 296-427
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.15e-19
Family Calcium ATPase, transduction domain A 0.0025
Further Details:      
 
Domain Number 4 Region: 535-725
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.24e-19
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005897   Gene: ENSGGOG00000006026   Transcript: ENSGGOT00000006055
Sequence length 1202
Comment pep:known_by_projection chromosome:gorGor3.1:19:20024959:20043619:-1 gene:ENSGGOG00000006026 transcript:ENSGGOT00000006055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGPACSVALALPSPGCHGGAQGLPEPGPQPRALLAAGPALIANGDELVAAVWPYRRLALL
RRLTVLPFAGLLYPAWLGAAAAGCWGWGSSWVQIPEAALLVLATICLAHALTVLSGHWSV
HAHCALTCTPEYDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYSYD
ALEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNKAEMVVPDFSELFKERA
TAPFFVFQVFCVGLWCLDEYWYYSVFTLSMLVAFEASLVQQQMRNMSEIRKMGNKPHMIQ
VYRSRKWRPIASDEIVPGDIVSIGRSPQENLVPCDVLLLRGRCIVDEAMLTGESVPQMKE
PIEDLSPDRVLDLQADSRLHVIFGGTKVVQHIPPQKATTGLKPVDSGCVAYVLRTGFNTS
QGKLLRTILFGVKRVTANNLETFIFILFLLVFAIAAAAYVWIEGTKDPSRNRYKLFLECT
LILTSVVPPELPIELSLAVNTSLIALAKLYMYCTEPFRIPFAGKVEVCCFDKTGTLTSDS
LVVRGVAGLRDGKEVTPVSSIPVETHRALASCHSLMQLDDGTLVGDPLEKAMLTAVDWTL
TKDEKVFPRSIKTQGLKIHQRFHFASALKRMSVLASYEKLGSTDLCYIAAVKGAPETLHS
MFSQCPPNYHHIHTEISREGARVLALGYKELGHLTHQQAREVKREALECSLKFVGFIVVS
CPLKADSKAVIREIQNASHRVVMITGDNPLTACHVAQELHFIEKAHTLILQPPSEKGRQC
EWRSIDGSIVLPLARGSPKALALEYALCLTGDGLAHVQATDPQQLLHLIPHVQVFARVAP
KQKEFVITSLKELGYVTLMCGDGTNDVGALKHADVGVALLANAPERVVERRRRPRESPTV
SNSGIRATSRTAKQRSGLPPSEEQPTSQRDRLSQVLRDLEDESTPIVKLGDASIAAPFTS
KLSSIQCICHVIKQGRCTLVTTLQMFKILALNALILAYSQSVLYLEGVKFSDFQATLQGL
LLAGCFLFISRSKPLKTLSRERPLPNIFNLYTILTVMLQFFVHFLSLVYLYREAQARSPE
KQEQFVDLYKEFEPSLVNSTVYIMAMAMQMATFAINYKGPPFMESLPENKPLVWSLAVSL
LAIIGLLLGSSPDFNSQFGLVDIPVEFKLVIAQVLLLDFCLALLADRVLQFFLGTPKLKV
PS
Download sequence
Identical sequences ENSGGOP00000005897 ENSGGOP00000005897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]