SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005931 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005931
Domain Number 1 Region: 211-404
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.86e-63
Family Reprolysin-like 0.00012
Further Details:      
 
Domain Number 2 Region: 423-499
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.22e-19
Family Blood coagulation inhibitor (disintegrin) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005931   Gene: ENSGGOG00000006056   Transcript: ENSGGOT00000006089
Sequence length 819
Comment pep:known_by_projection chromosome:gorGor3.1:8:39245903:39354823:1 gene:ENSGGOG00000006056 transcript:ENSGGOT00000006089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGAGFPSGTLRVRWLLLLGLVGPVLGAARPGFQQTSHLSSYEIITPWRLTRERREAPR
PYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYV
EGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVHKEPLKCGVSNK
DIEKETAKDEEEEPPSMTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQTAVREEMI
LLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDS
AQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDG
RDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAYSAPSCGNK
LVDAGEECDCGTPKECELDPCCEGSTCKLKSFAECAYGDCCKDCRFLPGGTLCRGKTSEC
DVPEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYNGMCQYYDAQCQVIFGSKAKAAPKDCF
IEVNSKGDRFGNCGFSGNEYKKCATGNALCGKLQCENVQEIPVFGIVPAIIQTPSRGTKC
WGVDFQLGSDVPDPGMVNEGTKCGAGKICRNFQCVDASVLNYDCDVQKKCHGHGVCNSNK
NCHCENGWAPPNCETKGYGGSVDSGPTYNEMNTALRDGLLVFFFLIVPLIVCAIFIFIKR
DQLWRSYFRKKRSQTYESDGKNQANPSRQPGSVPRHVSPVTPPREVPIYENRFAVPTYAA
KQPQQFPSRPPPPQPKVSSQGNLIPARPAPAPPLYSSLT
Download sequence
Identical sequences G3QTB8
XP_004046960.1.27298 ENSGGOP00000005931 ENSGGOP00000005931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]