SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005951 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005951
Domain Number 1 Region: 78-203
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Domain Number 2 Region: 19-82
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-17
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005951   Gene: ENSGGOG00000006082   Transcript: ENSGGOT00000006109
Sequence length 437
Comment pep:known_by_projection chromosome:gorGor3.1:6:40286897:40293906:-1 gene:ENSGGOG00000006082 transcript:ENSGGOT00000006109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFG
VPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPFVF
MVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSLFV
NWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVKGSTASKDVNIFSFLSKKEETYN
DLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLVPLVVYSKNRVPTLEEVSQTL
RSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASITF
VNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSDESTFTSTESELSVP
YEQLMNEYNKANSPKGT
Download sequence
Identical sequences G3QTD8
ENSGGOP00000005951 ENSGGOP00000005951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]