SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005952 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005952
Domain Number 1 Region: 147-399
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.2e-69
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 449-760
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.47e-43
Family Extended AAA-ATPase domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005952   Gene: ENSGGOG00000006080   Transcript: ENSGGOT00000006110
Sequence length 844
Comment pep:known_by_projection chromosome:gorGor3.1:8:45741995:45757669:1 gene:ENSGGOG00000006080 transcript:ENSGGOT00000006110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVTQARSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFSSPPQMHSSA
IPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDI
VASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDFTEPLYMQRLGE
INVIGEPFLNVNCEHIKSFDKNLYRQLVSYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQ
VRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDR
GRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLV
DKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQK
LFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK
FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQ
TGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANP
IESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQAEE
ELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIR
LAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKE
ELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKT
VRLL
Download sequence
Identical sequences ENSGGOP00000005952 ENSGGOP00000005952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]