SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005983 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000005983
Domain Number - Region: 142-189
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00785
Family Heat shock protein 15 kD 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005983   Gene: ENSGGOG00000006113   Transcript: ENSGGOT00000006142
Sequence length 240
Comment pep:known_by_projection chromosome:gorGor3.1:6:106992494:107015252:1 gene:ENSGGOG00000006113 transcript:ENSGGOT00000006142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFY
NIFSLRLPGLLLSPECIFPFSIRLKSNIRSTKSTKKSLQKVDEEDSDEESDHDEMSEQEE
ELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSR
TVKVGDTLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKKRMSK
Download sequence
Identical sequences A0A2I2YCK1
ENSGGOP00000005983 ENSGGOP00000005983 XP_004044520.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]