SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005985 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005985
Domain Number 1 Region: 57-153,300-425,1102-1315
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.62e-60
Family Calcium ATPase, transmembrane domain M 0.028
Further Details:      
 
Domain Number 2 Region: 426-442,891-1099
Classification Level Classification E-value
Superfamily HAD-like 1.02e-33
Family Meta-cation ATPase, catalytic domain P 0.071
Further Details:      
 
Domain Number 3 Region: 717-897
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.00000000000000207
Family Metal cation-transporting ATPase, ATP-binding domain N 0.019
Further Details:      
 
Domain Number 4 Region: 157-222,258-295
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000000000000693
Family Calcium ATPase, transduction domain A 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005985   Gene: ENSGGOG00000006109   Transcript: ENSGGOT00000006144
Sequence length 1461
Comment pep:known_by_projection chromosome:gorGor3.1:5:144660559:144948188:-1 gene:ENSGGOG00000006109 transcript:ENSGGOT00000006144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSVDSWWHRWQWRVRDGFPHCPSETTPLLSPEKGRQSYNLTQQRVVFPNNSIFHQDWE
EVSRRYPGNRTCTTKYTLFTFLPRNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITML
PLAIVLFVIMIKDGMEDFKRHRFDKAINCSNIRIYERKEQTYVQKCWKDVRVGDFIQMKC
NEIVPADILLLFSSDPNGICHLETASLDGETNLKQRRVVKGFSQQEVQFEPELFHNTIVC
EKPNNHLNKFKGYMEHPDQTRTGFGCESLLLRGCTIRNTEMAVGIVIYAGHETKAMLNNS
GPRYKRSKIERRMNIDIFFCSGILILMCLIGAVGHSIWNGTFEEHPPFDVPDANGNFLPS
ALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFLLSNDLDLYDEETDLSIQCRALNI
AEDLGQIQYIFSDKTGTLTENKMVFRRCTIMGSEYSHQENAKRLETPKELDSDGEEWTQY
QCLSFPARWAQDPATMRSQKGAQPLRRSQSARVPIQGHYRQRSMGHHESSQPPVAFSSSI
EKDVTPDKNLLTKVRDAALWLETLSDSRPAKASLSTTSSIADFFLALTICNSVMVSTTTE
PRQRVTIKPSSKALGTSLEKIQQLFQKLKLSSLSQSFSSTAPSDTDLGESLGANVATTDS
DERDDASVCSGGDSTDDGGYRSSMWDQGDILESGSGTSLEEALEAPATDLARPEFCYEAE
SPDEAALVHAAHAYSFTLVSRTPEQVTVRLPQGTCLTFSLLCTLGFDSVRKRMSVVVRHP
LTGEIVVYTKGADSVIMDLLEDPACVPDINMEKKLRKIRARTQKHLDLYARDGLRTLCIA
KKVVSEEDFQRWASFRREAEASLDNRDELLMETAQHLENQLTLLGATGIEDRLQEGVPDT
IATLREAGIQLWVLTGDKQETAVNIAHSCRLLNQTDTVYTINTENQETCESILNCALEEL
KQFRELQKPDRKLFGFRLPSKTPSITSEAVVPEAGLVIDGKTLNAIFQGKLEKKFLELTQ
YCRSVLCCRSTPLQKSMIVKLVRDKLRVMTLSIGDGANDVSMIQAADIGIGISGQEGMQA
VMSSDFAITRFKHLKKLLLVHGHWCYSRLARMVAYYLYKSVCYVNLLFWYQFFCGFSSST
MIDYWQMIFFNLFFTSLPPLVFGVLDKDISAETLLALPELYKSGQNSECYNLSTFWISMM
DAFYQSLICFFIPYLTYKGSDIDVFTFGTPINTISLTTILLHQAMEMKTWTIFHGVVLLS
SFLMYFLVSLLYNGTCIICNSPTNPYWVMEGQLSNPTFYLVCFLTPVVALLPRYFFLSLQ
GTCGKSLISKAQKIDKLPPDKRNLEIQSWRSRQRPAPVPEVARPTHHPVSSITGRDFSAS
TPKSSNPPKRKHVEESVLHEQRCGTECMRDDSCSGDSSAQLSSGEHLLGPNRIMAYSRGQ
TDMSRCSKRSSHRRSQSSLTI
Download sequence
Identical sequences ENSGGOP00000005985 ENSGGOP00000005985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]