SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000005987 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000005987
Domain Number 1 Region: 34-140,328-632
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.84e-66
Family Integrin alpha N-terminal domain 0.000045
Further Details:      
 
Domain Number 2 Region: 160-350
Classification Level Classification E-value
Superfamily vWA-like 1.28e-47
Family Integrin A (or I) domain 0.00000084
Further Details:      
 
Domain Number 3 Region: 787-932
Classification Level Classification E-value
Superfamily Integrin domains 3.09e-29
Family Integrin domains 0.006
Further Details:      
 
Domain Number 4 Region: 632-785
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-28
Family Integrin domains 0.0049
Further Details:      
 
Domain Number 5 Region: 964-1104
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000889
Family Integrin domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000005987   Gene: ENSGGOG00000006102   Transcript: ENSGGOT00000006146
Sequence length 1177
Comment pep:known_by_projection chromosome:gorGor3.1:16:32177205:32211092:1 gene:ENSGGOG00000006102 transcript:ENSGGOT00000006146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CALSPTFHFPSTCCSGMTFSTVLLLSVLASYHGFNLDVEEPTIFQEDAGGFGQSVVQFGG
SRLVVGAPLEVVAANQTGRLYDCAAATGMCQPIPLHIRPEAVNMSLGLTLAASTNGSRLL
ACGPTLHRVCGENSYSKGSCLLLGSRWEIIQTVPDATPECPHQEMDIVFLIDGSGSIDQN
DFNQMKGFVQAVMGQFEGTDTLFALMQYSNLLKIHFTFTQFRTSPSQQSLVDPIVQLKGL
TFTATGILTVVTQLFHHKNGARKSAKKILIVITDGQKYKDPLEYSDVIPQAEKAGIIRYA
IGVGHAFQGPTARQELNTIGSAPPQDHVFKVDNFAALGSIQKQLQEKIYAVEGTQSRASS
SFQHEMSQEGFSTALTMDGLFLGAVGSFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYL
GYSTELALWKGVQNLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGMQIGSYFGASLCSV
DVDSDGSTDLILIGAPHYYEQTRGGQVSVCPLPRGRVQWQCDAVLRGEQGHPWGRFGAAL
TVLGDVNEDKLIDVAIGAPGEQENRGAVYLFHGASESGISPSHSQRIAGSQLSPRLQYFG
QALSGGQDLTQDGLMDLAVGARGQVLLLRSLPVLKVGVAMRFSPVEVAKAVYRCWEEKPS
ALEAGDVTICLTIQKSSLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLG
LGIHCETLKLLLPDCVEDVVSSIILHLNFSLVREPIPSPQNLRPVLAMGSQDLFTASLPF
EKNCGQDGLCEGDLGVTLSFSGLQTLTVGSSLELNVIVTVWNAGEDSYGTVVSLYYPAGL
SHRRVSGAQKQPHQSALRLACETVPTEDEGLRSSRCSVNHPIFHEGSNGTFIVTFDVSYK
ATLGDRMLMRASASSENNKASSSKATFQLELPVKYAVYTMISRQEESTKYFNFATSDEKK
MKEAEHRYRVNNLSQRDLAISINFWVPVLLNGVAVWDVVMEAPSQSLPCVSERKPPQHSD
FLTQISRSPMLDCSIADCLQFRCDVPSFSVQEELDFTLKGNLSFGWVRETLQKKVSVVSV
AEITFDTSVYSQLPGQEAFMRAQMEMVLEEYEVYNAIPIIMGSSVGALLLLALITATLYK
LGFFKRHYKEMLENKPEDTATFSGDDFSCVAPNVPLS
Download sequence
Identical sequences ENSGGOP00000005987 ENSGGOP00000005987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]