SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006014 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006014
Domain Number 1 Region: 208-488,540-688
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000121
Family Hermes transposase-like 0.036
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006014
Domain Number - Region: 1-46
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00784
Family THAP domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006014   Gene: ENSGGOG00000006152   Transcript: ENSGGOT00000006176
Sequence length 720
Comment pep:novel chromosome:gorGor3.1:11:73350186:73378443:-1 gene:ENSGGOG00000006152 transcript:ENSGGOT00000006176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNFCAAPNCTRKSTQSDLAFFRFPRDPASPYRTVLRDNAIPTIFDLTSHLNNPHSRHRK
RIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKE
NKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFE
TTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVR
FVDESHNLREEFIGFLPYEADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMK
VVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLEL
DNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNVRWNN
YIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSL
NEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFRRAHQGNLESQLTSESYYKETLSVP
TVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAE
LHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGR
KRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLCTSKSELPTDNSETVENT
Download sequence
Identical sequences ENSGGOP00000006014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]