SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006027 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006027
Domain Number 1 Region: 311-370
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00017
Further Details:      
 
Domain Number 2 Region: 257-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.76e-16
Family Erythroid transcription factor GATA-1 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006027   Gene: ENSGGOG00000006161   Transcript: ENSGGOT00000006189
Sequence length 444
Comment pep:known_by_projection chromosome:gorGor3.1:10:8266992:8290811:1 gene:ENSGGOG00000006161 transcript:ENSGGOT00000006189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSAPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
Download sequence
Identical sequences G3QTK0
XP_004049093.1.27298 XP_018891155.1.27298 XP_018891157.1.27298 ENSGGOP00000006027 ENSGGOP00000006027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]