SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006094 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006094
Domain Number 1 Region: 21-169
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.44e-59
Family Nucleoside diphosphate kinase, NDK 0.0000000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006094   Gene: ENSGGOG00000006229   Transcript: ENSGGOT00000006258
Sequence length 169
Comment pep:known_by_projection chromosome:gorGor3.1:16:1877502:1878895:-1 gene:ENSGGOG00000006229 transcript:ENSGGOT00000006258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQA
PEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVSTSRALIGATNPADAPPGT
IRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Download sequence
Identical sequences G3QTR3
ENSGGOP00000006094 XP_004057003.1.27298 ENSGGOP00000006094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]