SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006100 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006100
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.45e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006100   Gene: ENSGGOG00000006235   Transcript: ENSGGOT00000006264
Sequence length 450
Comment pep:novel chromosome:gorGor3.1:15:24390435:24447179:1 gene:ENSGGOG00000006235 transcript:ENSGGOT00000006264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTE
LNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVK
KYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHITPPMSP
PDVLKTSPVADAAGWVDVDKETLQHKRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYVMKAD
LMPFLYWNMMLRGYWGGPAFLRKLFHLGMS
Download sequence
Identical sequences G3QTR8
ENSGGOP00000006100 ENSGGOP00000006100 XP_004056181.1.27298 XP_018866388.1.27298 XP_018866389.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]