SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006107 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006107
Domain Number 1 Region: 1-235
Classification Level Classification E-value
Superfamily HAD-like 1.46e-31
Family MtnX-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006107   Gene: ENSGGOG00000003740   Transcript: ENSGGOT00000006271
Sequence length 241
Comment pep:known_by_projection chromosome:gorGor3.1:2b:57502031:57509256:1 gene:ENSGGOG00000003740 transcript:ENSGGOT00000006271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGV
REHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDK
VFTNPAAFNSNGHLTVENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDG
GNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLEPMEYSVVVWSSGVDIISHLQFLIK
D
Download sequence
Identical sequences G3QTS4 Q8TCD6
NP_001008489.1.87134 NP_001008489.1.92137 NP_001186214.1.87134 NP_001186214.1.92137 NP_001186215.1.87134 NP_001186215.1.92137 NP_001186216.1.87134 NP_001186216.1.92137 NP_001186217.1.87134 NP_001186217.1.92137 XP_004032803.1.27298 XP_004032804.1.27298 XP_004032806.1.27298 XP_018877637.1.27298 XP_018877638.1.27298 XP_018877639.1.27298 9606.ENSP00000352782 ENSP00000352782 ENSGGOP00000006107 GO.79310 ENSP00000352782 ENSP00000481046 ENSP00000481680 ENSP00000481857 gi|313151191|ref|NP_001186214.1| gi|313151193|ref|NP_001186215.1| gi|313151195|ref|NP_001186216.1| gi|313151197|ref|NP_001186217.1| gi|56606064|ref|NP_001008489.1| ENSP00000352782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]