SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006112 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006112
Domain Number 1 Region: 93-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-52
Family SPRY domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006112
Domain Number - Region: 275-311
Classification Level Classification E-value
Superfamily SOCS box-like 0.00445
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006112   Gene: ENSGGOG00000006245   Transcript: ENSGGOT00000006276
Sequence length 355
Comment pep:known_by_projection chromosome:gorGor3.1:16:1884062:1889963:-1 gene:ENSGGOG00000006245 transcript:ENSGGOT00000006276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRPRNSRAWHFVLSAARRDADARAVALAGSTNWGYDSDGQHSDSDSDPEYSMLPPSIP
SAVPVTGESFCDCAGQSEASFCSSLHSAHRGKDCRCGEEDEYFDWVWDDLNKSSATLLSC
DNRKVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRH
TFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCI
GVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLP
LPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRCRRT
Download sequence
Identical sequences G3QTS9
ENSGGOP00000006112 ENSGGOP00000006112 XP_004057000.1.27298 XP_018867381.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]