SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006177 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006177
Domain Number 1 Region: 198-496
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.17e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000215
Further Details:      
 
Domain Number 2 Region: 498-606
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.51e-26
Family Anticodon-binding domain of Class II aaRS 0.001
Further Details:      
 
Domain Number 3 Region: 130-197
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.0000000000000249
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.01
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000567
Family TGS domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006177   Gene: ENSGGOG00000006311   Transcript: ENSGGOT00000006343
Sequence length 615
Comment pep:known_by_projection chromosome:gorGor3.1:1:129349188:129368809:1 gene:ENSGGOG00000006311 transcript:ENSGGOT00000006343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYQRWRCLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKACGTLVDLCQGPHLRHTGQIGGLKLLSNSSSLWRSSGAPQTLQRVSGISFPT
TELLRAWEAWREEAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEY
AHRGFSEVKTPTLFSTKLWEQSGHWEHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLA
LKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFC
TTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFG
EPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVL
IHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVS
DLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLSEAVQRL
VELQNTRVPNAEEIF
Download sequence
Identical sequences G3QTZ0
ENSGGOP00000006177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]