SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006181 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006181
Domain Number 1 Region: 780-993
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.63e-78
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000000192
Further Details:      
 
Domain Number 2 Region: 660-781
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 9.68e-40
Family Domain of poly(ADP-ribose) polymerase 0.000000445
Further Details:      
 
Domain Number 3 Region: 520-641
Classification Level Classification E-value
Superfamily WGR domain-like 3.01e-33
Family WGR domain 0.000000396
Further Details:      
 
Domain Number 4 Region: 111-216
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.46e-31
Family PARP-type zinc finger 0.0072
Further Details:      
 
Domain Number 5 Region: 7-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.82e-30
Family PARP-type zinc finger 0.0066
Further Details:      
 
Domain Number 6 Region: 388-465
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000036
Family DNA ligase 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006181   Gene: ENSGGOG00000006308   Transcript: ENSGGOT00000006347
Sequence length 997
Comment pep:known_by_projection chromosome:gorGor3.1:1:206522378:206569559:-1 gene:ENSGGOG00000006308 transcript:ENSGGOT00000006347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMLDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSAASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQIKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRHWIFRSWGRVGTVIGSNK
LEQMPSKEDTIEHFMKLYEEKRNAWHSKNTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTK
SKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKAVSQGSSDSQILDLSNRFY
TLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKL
KTDIKVIDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNR
RLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIG
LILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISS
GVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
Download sequence
Identical sequences ENSGGOP00000006181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]