SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006190 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006190
Domain Number 1 Region: 147-344
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.8e-57
Family Prokaryotic proteases 0.0000000135
Further Details:      
 
Domain Number 2 Region: 359-455
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-24
Family HtrA-like serine proteases 0.00000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006190   Gene: ENSGGOG00000006327   Transcript: ENSGGOT00000006356
Sequence length 458
Comment pep:known_by_projection chromosome:gorGor3.1:2a:75909113:75913264:1 gene:ENSGGOG00000006327 transcript:ENSGGOT00000006356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWAR
LSVRVTEPRACLTSGTPGPRAQLTAVTPDTRTQEASENSGTRSRAWLAVALGAGGAVLLL
LWGGGRGPPAVLAAVPGPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRR
YIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Download sequence
Identical sequences G3QU02
ENSGGOP00000006190 XP_004029527.1.27298 ENSGGOP00000006190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]