SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006210 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006210
Domain Number 1 Region: 1581-1689
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 882-997
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-33
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 3 Region: 1932-2041
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 4 Region: 709-828
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-32
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 5 Region: 2104-2212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 6 Region: 2270-2389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-31
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 7 Region: 65-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-29
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 8 Region: 1401-1517
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-28
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 9 Region: 542-652
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 10 Region: 2458-2562
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 11 Region: 1061-1170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 12 Region: 1234-1343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 13 Region: 1749-1864
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 14 Region: 3165-3236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.99e-21
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 15 Region: 241-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 16 Region: 2810-2878
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.29e-19
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 17 Region: 3049-3117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-18
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 18 Region: 2867-2935
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.78e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2925-2998
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.05e-18
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 20 Region: 3106-3176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 3225-3294
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.36e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 2751-2820
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 23 Region: 2217-2286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000189
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 24 Region: 2624-2691
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 3284-3340
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 3345-3413
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000347
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 2981-3042
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000459
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 28 Region: 479-550
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000528
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 29 Region: 2045-2107
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000607
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 30 Region: 2562-2635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 1521-1585
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000432
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 1003-1063
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000737
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 33 Region: 1694-1759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000001
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 34 Region: 657-716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 35 Region: 1871-1937
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 36 Region: 1176-1238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000405
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 37 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000513
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 38 Region: 1347-1409
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000133
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 39 Region: 3404-3462
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 40 Region: 828-896
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000364
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 41 Region: 2698-2762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000528
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 42 Region: 2388-2451
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000702
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006210   Gene: ENSGGOG00000006309   Transcript: ENSGGOT00000006377
Sequence length 3701
Comment pep:known_by_projection chromosome:gorGor3.1:8:111640140:112873136:-1 gene:ENSGGOG00000006309 transcript:ENSGGOT00000006377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEIRKGESRAKESKPWEPGTRRCAKCGRLDFILMKKMGIKSGFTFWNLVFLLTVSYVKG
FIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYDYLS
LYDGHPHPANFRTRLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSSCGN
PGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIANSVNTASWDFPVPICRAEDA
CGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTIWVNSFYPCMLYSINKYKYVDSNHRYKYLCLNVGSSTLTHTTSTGELEEHNRTTTG
AIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTR
RRPRHAEQIERTKELAVVTHRVKKAIDFKSRGFKLFPGKDNSNKFSILNEGGIKTASNLC
PDPGEPENGKRIGSDFSLGSTVQFSCAEDYVLQGAKSITCQRIAEVFAAWSDHRPVCKVK
TCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTNKVIQINFEEFDLEIGYDTLTIG
DGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLHLQTDESVGSVGFKVNYKEIEKESCGD
PGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVCQENNQWSANIPICIFPCLSNFT
APMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFNDFDLESQFDFLAVKDGDSPESP
ILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNITYNTFGHNECPDPGIPINARRF
GDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMWSGPIPKCGAPCGGHFSAPSGVI
LSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTELNYDVLEVHDGPNLLSPLLGSYN
GTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHYESVTVNTYSCLDPGIPVHGRRYGHDF
SIGSTVSFSCDSGYRLSHEEPLLCEKNHWWSHPLPTCDALCGGDVRGPSGTILSPGYPEF
YPNSLNCTWTVDVTHGKGVQFNFHTFHLEDHHDYLLITENGSFTQPLARLTGSDLPPTIN
AGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCEDPGIPQYGSRIGFNFGIGDTLTF
SCSSGYRLEGTSEIICLGGGRRVWSAPLPRCVAECGASATNNEGILLSPNYPLNYENNHE
CIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTTHLLGAFTGASMRGLTLSSTSNQ
LWLEFNSDSEGTDEGFQLVYTSFELSHCEDPGIPQFGYKISDQGHFAGSTIIYGCNPGYT
LHGSSLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNNLRCMWMIE
VDPGNIVSLQFLAFDTEASHDILRVWDGPPENEMLLKEISGSLIPEGIHSTLNTVTIQFD
TDFYISKSGFAIQFSSSVATACRDPGVPMNGTRNGDGREPGDTVVFQCDPGYELQGEERI
TCIQVENRYFWQPSPPVCIAPCGGNLTGSSGFILSPNFPHPYPHSRDCDWTITVNADYVI
SLAFISFSIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPERIESSSNTMHLAFRSDGSVSY
TGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLGSTVTYYCDAGYVLQGYSTLTCIMGDD
GRPGWNRALPSCHAPCGSRSTGSEGTVLSPNYPKNYSVGHNCVYSIAVPKEFVVFGQFVF
FQTSLHDVVEVYDGPTQQSSLLSSLSGSHSGESLPLSSGNQITIRFTSVGPITAKGFHFV
YQAVPRTSSTQCSSVPEPRFGRRIGNEFAVGSSVLFDCNPGYILHGSIAIRCETVPNSLA
QWNDSLPTCIVPCGGILTKRKGTILSPGYPEPYDNNLNCVWKITVPEGAGIQVQVVSFAT
EHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNSTSNNLYLNFQSDISVSAAGFHLEYTA
IGLDSCPEPQTPSNGIKIGDRYMVGDVVSFQCDQGYSLQGHSHITCMPGPVRRWNYPIPI
CLAQCGGAMSDFSGVILSPGFPGNYPSSLDCTWTINLPIGFGVHLQFVNFSTETIHDYLE
VRSGSSETSTVIGRLSGPQIPSSLFSTTHETSLYFHSDYSQNKQGFHIVYQAYQLQSCPD
PRPFRNGFVIGNDFTVGQTISFECFPGYTLIGNSALTCLHGVSRNWNHPLPRCEALCGGN
ITAMNGTIYSPGYPDEYPNFQDCFWLVRVPPGNGIYINFTVLQTEPIYDFITVWDGPDQN
SPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFVLSYHAYQLRVCQPPPPVPNAEI
LTEDDEFEIGDIIRYQCLPGFTLVGNAILTCRLGERLQMDGAPPVCQVLCPANELRLDST
GVILSPGYPDSYPNLQMCAWSISVEKGYNITMFVEFFQTEKEFDVLQVYDGPNIQSPVLI
SLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGFRIRYIAFYCSTPESPPHGYIISQTGG
QLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHAWDAPVPACQAISCGIPKAPTNGGILTT
DYLVGTRVTYFCNDGYRLSSKELTTAVCQSDGTWSNHNKTPRCVVVTCPSINSFTLEHGR
WRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLPNGTWSWRNERPYCQIISCGELPTPP
NGNKIGTQTSYGSTAIFTCDLGFMLVGSAVRECLSSGLWSESETRCLAGHCGIPELIVNG
QVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVPVSCGHPGSPIYGRT
SGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPMCKVVNCSDPGIPANSKRES
KIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGQWDKPLPECIMIDCGHPGVPPNAVL
SGEKYTFGSTVHYSCTGKRSLLGQSSRTCQLNGHWSGSQPHCSGDATGTCGDPGTPGHGS
RQESNFRTKSTVRYACDTGYILHGSEERTCLANGSWTGRQPECKAVQCGNPGTTANGKVF
RIDGTTFSSSVIYSCMEGYILSGPSVRQCTANGTWSGTLPNCTIISCGDPGIPANGLRYG
DDYVVGQNVSYMCQPGYTMELNGSRIRTCTINGTWSGVMPTCRAVTCPTPPQISNGRLEG
TNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSGEVPQCLPKFCGDPGIPAQGKREGKS
FIYQSEVSFSCNSPFILVGSSTRICQADGTWSGSSPHCIEPTRTSCENPGVPRHGSQNNT
FGFQVGSVVQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECIPHSCKQPETPAHANVVGMD
LPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPICEAGSKILVKDPRPALGTPSP
KLSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTSFNASTGRVNATLSNSNMELLLSGVYK
SQEARLMLRIYLIKVPAHASVKKMKEENWAMDGFVSAEPDGATYVFQGFIQGKDYGQFGL
QRLGLNMSEGSNSSNQPHGTNSSSVAIAILVPFFALIFAGFGFYLYKQRTAPKTQYTGCS
VHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences ENSGGOP00000006210 ENSGGOP00000006210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]