SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006211 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006211
Domain Number 1 Region: 1500-1830
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 3.53e-93
Family Rap/Ran-GAP 0.00016
Further Details:      
 
Domain Number 2 Region: 510-636,901-1286
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000204
Family Plakophilin 1 helical region 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006211   Gene: ENSGGOG00000006329   Transcript: ENSGGOT00000006378
Sequence length 1846
Comment pep:known_by_projection chromosome:gorGor3.1:20:20948906:21256458:-1 gene:ENSGGOG00000006329 transcript:ENSGGOT00000006378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTLLDNVDANDLKQFFETNYSQIYFIFYENFITLENSLKLKGNNKSQREELDSILFLFE
KILQFLPERIFFRWHYQSIGSTLKKLLHTGNSIKIRCEGIRLFLLWLQALQTNCAEEQVL
IFACLVPGFPAVMSSRGPCTLETLINPSPSVADVKIYPEEITPLLPAISGEKIAEDQTCF
FLQILLKYMVIQAASLEWKNKENQDTGFKFLFTLFRKYYLPHLFPSFTKLTNIYKPVLDI
PHLRPKPVYITTTRDNENIYSTKIPYMAARVVFIKWIVTFFLEKKYLTATQNTKNGVDVL
PKIIQTVGGGAVQERAPELDGGGPTEQDKSHSNSSTLSDRRLSNSSLCSIEEEHRMVYEM
VQRILLSTRGYVNFVNEVFHQAFLLPSCEIAVTRKVVQVYRKWILQDKPVFMEEPDRKDV
AQEDAEKLGFSETDSKEASSESSGHKRSSSWGRTYSFTSAMSRGCVTEEENTNVKAGVQA
LLQVFLTNSANVFLLEPCAEVPVLLKEQVDACKAVLIIFRRMIMELTMNKKTWWPREQML
QILLRITEAVMQKPKDKQIKDLFAQSLAGLLFRTLMVAWIRANLCVYISRELWDDFLGVL
SSLTEWEELINEWANIMDSLTAVLARTVYGVEMTNLPLDKLSEQKEKKQRGKGCVLDPQK
GTTVGRSFSLSWRSHPDVTEPMRFRSATTSGAPGVEKARNIVRQKATEVEECQQSENAPA
AGSGHLTVGQQQQVLRSSSTSDIPEPLCSDSSQGQKAENTQNSSSSEPQPIQENKGHVKR
EHEGITILVRRSSSPAELDLKDDLQQTQGKCRERQKSESTNSDTTLGCTNEAELSMGPWQ
TCEEDPELNTPTDVVADADARHWLQLSPTDASNLTDSSECLTDDCSIIAGGSLTGWHPDS
AAVLWRRVLGILGDVNNIQSPKIHARVFCYLYELWYKLAKIRDNLAISLDNQSSPSPPVL
IPPLRMFASWLFKAATLPNEYKEGKLQAYRLICAMMTRRQDVLPNSDFLVHFYLVMHLGL
TSEDQDILNTIIRHCPPRFFSLGFPGFSMLVGDFITAAARVLSTDMLTAPRSEAVTVLGS
LVCFPNTYQEIPLLQSVPEVNEAITGTEDVKHYLINILLKNATEEPNEYARCIAVCSLGV
WICEELAQCTNHPQVKEAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETSLPR
KMAEILVATIAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSVLLHPVSTAILEEQ
HSARAPLLDYIYRVLHCCVCGSSTYTQQSHYILTLADLSSTDYDPFLPLANVKSSEPVQY
HSSAELGNLLTVEEEKKRRSLELIPLTARMVMAHLVNHLGHYPLSGGPAILHSLVSENHD
NAHVEGSELSSEVFRSPNLQLFVFNDSTLISYLQTPTEGPAGGSPVGSLSDVRVIVRDIS
GKYSWDGKVLYGPLEGCLAPNGRNPSFLISSWHRDTFGPQKDSSQVEEGDDVLDKLLENI
GHTSPECLLPSQLNLNEPSLPPCGMNYDQEKEIIEVILRQNAQEDEYIQSHNFDSAMKVT
SQGQPSPVEPRGPFYFCRLLLDDLGMNSWDRRKNFHLLKKNSKLLRELKNLDSRQCRETH
KIAVFYIAEGQEDKCSILSNERGSQAYEDFVAGLGWEVDLSTHCGFMGGLQRNGSTGQTA
PYYATSTVEVIFHVSTRMPSDSDDSLTKKLRHLGNDEVHIVWSEHSRDYRRGIIPTAFGD
VSIIIYPMKNHMFFIAITKKPEVPFFGPLFDGAIVSGKLLPSLVCATCINASRAVKCLIP
LYQSFYEERALYLEAIIQNHREVMTFEDFAAQVFSPSPSYSLSGTD
Download sequence
Identical sequences ENSGGOP00000006211 ENSGGOP00000006211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]