SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006230 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006230
Domain Number 1 Region: 27-202
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.05e-57
Family MHC antigen-recognition domain 0.00000000635
Further Details:      
 
Domain Number 2 Region: 210-299
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-27
Family C1 set domains (antibody constant domain-like) 0.00000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006230   Gene: ENSGGOG00000006373   Transcript: ENSGGOT00000006399
Sequence length 348
Comment pep:known_by_projection chromosome:gorGor3.1:6:26954345:26962140:1 gene:ENSGGOG00000006373 transcript:ENSGGOT00000006399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVF
YDHESRRVEPRTPWVSSRISSQVWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQV
ILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNR
AYLERDCPAQLQQLLELGRGLLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWL
KDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
PSGTLVIGVISGIAVFFVILFIGILFIILRKRQGSRGAMGHYVLAERE
Download sequence
Identical sequences G3QU39
ENSGGOP00000006230 XP_004043416.1.27298 ENSGGOP00000006230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]