SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006260 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006260
Domain Number 1 Region: 139-207
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.25e-17
Family SNARE fusion complex 0.0000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006260   Gene: ENSGGOG00000006399   Transcript: ENSGGOT00000006429
Sequence length 236
Comment pep:known_by_projection chromosome:gorGor3.1:17:9512112:9849465:-1 gene:ENSGGOG00000006399 transcript:ENSGGOT00000006429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPDPKFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKD
LLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGA
PNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQN
EIIDDLANLVENTDEKLHNETRRVNMVDRKSASCGMIMVILLLLVAIVVVAVWPTN
Download sequence
Identical sequences ENSGGOP00000006260 ENSGGOP00000006260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]