SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006268 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006268
Domain Number 1 Region: 152-272
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.36e-16
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.037
Further Details:      
 
Domain Number 2 Region: 36-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000484
Family Ubiquitin-related 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006268   Gene: ENSGGOG00000006409   Transcript: ENSGGOT00000006437
Sequence length 348
Comment pep:known_by_projection chromosome:gorGor3.1:1:187042206:187044703:-1 gene:ENSGGOG00000006409 transcript:ENSGGOT00000006437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPEGAWPVGSRTDTMWRLRCKAKDGTHVL
QGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLII
EEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAP
EMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVD
TQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQHNFPDPDTPPLTIFSSNDDIVLVQALEL
ADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
Download sequence
Identical sequences G3QU72
XP_018885455.1.27298 ENSGGOP00000006268 ENSGGOP00000006268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]