SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006294 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006294
Domain Number 1 Region: 100-476
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.45e-107
Family Formin homology 2 domain (FH2 domain) 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006294   Gene: ENSGGOG00000006436   Transcript: ENSGGOT00000006463
Sequence length 1143
Comment pep:known_by_projection chromosome:gorGor3.1:4:163215647:163252281:1 gene:ENSGGOG00000006436 transcript:ENSGGOT00000006463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVMNCVSLVSDKENGNSATAPGFMIGQTPPPAPPPPPPPPPPSPPCSCSREECLSSPPP
PPPPPLPGEPPIPPPPPGLPPTTHMNGYSHLGKKKRMRSFFWKTIPEEQVRGKTNIWTLA
ARQEHHYQIDTKTIEELFGQQEDTTKSSLPRRGRTLNSSFREAREEITILDAKRSMNIGI
FLKQFKKSPRSIVEDIHQGKTEHYGSETLREFLKFLPESEEVKKLKAFSGDVSKLSLADS
FLYGLIQVPNYSLRIEAMVLKKEFLPSCSSLYTDITVLRAAIKELMSCEELHSILHLVLQ
AGNIMNAGGYAGNAVGFKLSSLLKLADTKANKPGMNLLHFVAQEAQKKDTILLNFSEKLH
HVQKTARLSLENTEAELHLLFVRTKSLKENIQRDGELCQQMEDFLQFAVEKLRELECWKQ
ELQDEAYTLIDFFCEDKKTMKLDECFQIFRDFCTKFNKAVKDNHDREAQELRQLQRLKEQ
EQKQRSWATGELGAFGRSSSENDVELLTKKGAEGLLPFLHPRPISPSSPSYRPPNTRRSR
LSLGPSADRELLTFLESSTGSPEEPNKFHSLPRSSPRQARPTIACLEPAEVRHQDSSFAH
KPQASGGQEEAPNPPSAQAHQLAAAQPEDPASAFPRARRQGVSVLRKRYSEPVSLGSAQS
PPLSPLALGIKEHELVTGLAQFNLQGSQGMEETSQLTLSDFSPMELESVGHGGPQSLSAS
SSSLTPMGRDALGSLSPALEDGKAAPDEPGSAALGSVGSSDPENKDPRPLFCISDTTDCS
LTLDCSEGTDSRPRGGDPEEGGEGDGSMSSGVGEMGDSQVSSNPTSSPPGEAPAPVSVDS
EPSCKGGLPRDKPTKRKDVVAPKRGSLKEASPGASKPGSARRSQGAVAKSVRTLTASENE
SMRKVMPITKSSRGAGWRRPELSSRGPSQNPPSSTDTVWSRQNSVRRASTGAEEQRLPRG
SSSSSSTRPGRDVPLQPRGSFKKPSAKPLRNLPRQKPEENKTCRAHSEGPESPKEEPKTP
PVPSVPHELPSVPSFARNTVASSSRSMRTDLPPVAKAPGITRTVSQRQLRMKADPEDAAP
KDGSTLRRASSARAPKKRPESVEGPSANTEAPLKARGAGERASLRRKDSSRTTLGRILNP
LWK
Download sequence
Identical sequences ENSGGOP00000006294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]