SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006296 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006296
Domain Number 1 Region: 1245-1290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000754
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000006296
Domain Number - Region: 1281-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0524
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006296   Gene: ENSGGOG00000006434   Transcript: ENSGGOT00000006465
Sequence length 1422
Comment pep:known_by_projection chromosome:gorGor3.1:7:12429699:12494373:-1 gene:ENSGGOG00000006434 transcript:ENSGGOT00000006465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARRLYPTKGLGTTQNEDAELPCSKQQQTEKIQERRPEALLWPHPPGTRGPGSATPFAPPA
EAAMPGGACVLVIALMFLAWAEAQECSPGGHQFLRSPYRSVHFDSWHLQQSAVQDLICDH
SLSPGWYRFLVFDRPAEMPTKCVEMNHCGTQAPIWLSLRDSETLPSPGEIKQLTACATWQ
FLFSTTKDCCLFQIPVSVRNCGNFFVYLLQPTQGCMGYCAEAISDARLYPCGSDETEIGG
DCVRQLAASLPPPPAGRPKVLVELIESRLFCRCSFDVPATKNSVGFHIAWSRLSSQEVKE
ELTQETTVQAFSLLELDGINLRLGDKIFCSASVFFLENPHVQSVAIESQEFFAGIKLQPE
LSTISEDGKEYYLRIESTVPIICSEFSELYQECKISLKLKTIDQGREHLGLNLALSSCHV
DLLQTSSCANGTCSHTFVYYTAVTDFSRDGDRVTNIVVQPIVNEDFLWNNYIPDSIQIKV
KDVPTAYCYSFTDPHIITFDGRVYDNFKTGTFVLYKSMSRDFEVHVRQWDCGSLHHPVSC
NCGFVAQEGGDIVTFDMCNGQLRESQPYLFVKSQDVTRNIKISESYLGRKVTIWFSSGAF
IRADLGEWGMSLTIRAPSVDYRNTLGLCGTFDENPENDFHDKNGMQIDQNFKNYVAFVNE
WRILPGKSMFDTLPVSMTSPGKPSYCSCSLDTAAYPSSEDLDSVSRSEIALGCKDLSHVS
LSSLIPELDVTSEYINSDTLVREMNKHTSPEEYNLNFFLQEKKHINLTKLGLNVQKHPGN
EKQDSLQYLDNKKYTQGRGSHSQEMRYNRQNRWKRQNFHEFTPLFAFPSLSQTDLEELTY
FFPEDHAEDVQQEFFPSWPTPSGLTEYSTLTLCQETLANSSIGRLCLAFLGKRLDSVIDM
CVKDVLLKDDLRWAEAGVALLENECEKRVVEEGKCNTEEYGTSIEDILSVLKCPNLCSGN
GQCMEWGCACSPSFSSYDCSDSYDKAPEITELGNAGFCDVQKYNCMMVRVFGKGFKELPS
IKCEVAKLQYNSSEWMPGEPIYTQTVFHNSRAVDCQLPTDVQQFDTMDLVGGKPIGKWQL
KVSNDGYKFSNPKIMVIYDGACQVCGLYKNDSCTIKENVCIIDGLCYVEGDKNPTSPCLI
CRPKISRFTWSFLENNQPPVIQALQDKLQTFYGENFEYQFVAFDPEGSDIHFTLDSGPEG
ASVSSAGLFMWKTDLLTTQQFTLRLNDDCDAETRVTVEVTVKSCDCLNGGSCVSDRNFSP
GSGVYLCVCLPGFHGSLCEVDISGCQSNPCGLGSCISGFHGYSCDCPPELKVETQFLNKF
TTQAVVLTRSDKSVNREEDDKNAQGRKRHVKPTSGNVFTICKYPCGKSRECVAPNICKCK
PGYIGSNCQTALCDPDCKNHGKCIKPNICQCLPGHGGATCDE
Download sequence
Identical sequences ENSGGOP00000006296 ENSGGOP00000006296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]