SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006327 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006327
Domain Number 1 Region: 411-824
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.72e-110
Family Phosphofructokinase 0.00000718
Further Details:      
 
Domain Number 2 Region: 86-409
Classification Level Classification E-value
Superfamily Phosphofructokinase 8.37e-106
Family Phosphofructokinase 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006327   Gene: ENSGGOG00000006461   Transcript: ENSGGOT00000006496
Sequence length 851
Comment pep:known_by_projection chromosome:gorGor3.1:12:46042301:46081982:1 gene:ENSGGOG00000006461 transcript:ENSGGOT00000006496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKDEFHLKFFMCVVQSRQLVRTPQRTAGEASTSSMLIPKPPPKTDILKSLDTMDDPDTV
GSIPVFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATV
SNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEH
ITRKRSGEAAV
Download sequence
Identical sequences G3QUC7
XP_004053083.1.27298 XP_018894166.1.27298 XP_018894167.1.27298 ENSGGOP00000006327 ENSGGOP00000006327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]