SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006340 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006340
Domain Number 1 Region: 168-312
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-35
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 2 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-18
Family First domain of FERM 0.0077
Further Details:      
 
Domain Number 3 Region: 101-170
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000275
Family Second domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006340   Gene: ENSGGOG00000006477   Transcript: ENSGGOT00000006510
Sequence length 790
Comment pep:known_by_projection chromosome:gorGor3.1:14:70007188:70092976:-1 gene:ENSGGOG00000006477 transcript:ENSGGOT00000006510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
VTYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTVYFGVVFYVPSVSQLQQEITRYQY
YLQLKKDILEGSIPCTLEQAIQLAGLAVQGLTAPDAEMLYMQEVERMDGYGEESYPAKDS
QGSDISIGACLEGIFVKHKNGRHPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDM
ETAKYIWRLCVARHKFYRLNQCNLQTQTVTVNPIRRRSSSRMSLPKPQPYVMPPPPQLHY
NGHYTEPYASSQDNLFVPNQNGYYCHSQTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQ
PYLQPSPMSSNPSITGSDVMRPDYLPSHRHSALIPPSYRPTPDYETVMKQLNRGLVHAER
QSHSLRNLNIGSSYAYSRPAALVYSQPEIREHAQLPSPPAAHCPFSLSYSFHSPSPYPYP
AERRPVVGAVSVPELTNAQLQAQDYPSPNIMRTQVYRPPPPYPPPRPANSTPDLSRHLYI
SSSNPDLITRRVHHSVQTFQEDSLPVAHSLQEVSEPLTAARHAQLHKRNSIEVAGLSHGL
EGLRLKERTLSASAAEVAPRALSAGSQPSVFTERTQREGPEEVEGLRHGHKKSLSDATML
IHSSEEEEDEDFEEESGARAPPARAREPRPGLAQDPPGCPRVLLAGPLHILEPKAHVPDA
EKRMMDSSPVRTTAEAQRPWRDGLLMPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKK
NIVEGLPPLG
Download sequence
Identical sequences ENSGGOP00000006340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]