SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006360 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006360
Domain Number 1 Region: 12-110
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.57e-21
Family FHA domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006360   Gene: ENSGGOG00000006499   Transcript: ENSGGOT00000006530
Sequence length 1583
Comment pep:known_by_projection chromosome:gorGor3.1:14:86931874:86959565:1 gene:ENSGGOG00000006499 transcript:ENSGGOT00000006530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATSWFLVSSSGARHRLPRELIFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDL
GSLNGTFVNDMRIPDQKYVTLKLNDVIRFGYDSNMYVLERVQHRVPEEALKHEKYTSQLQ
VSVKGLAPKKSEALPEHTPYCEASNPRPEKGDRRPGTEAASYRTPLYGQPSWWGEDDGST
LPDAQRQGEPYPAERPKGPVQQDGELHGFRAPAEPQGCSFRREPSYFEIPTKETPQPSQP
PEVPAHEMPTKDAEAGGGGAAPVVQSHASFTIEFDDCSPGKMKIKDHITKFSLRQRRPPG
KEATPGEMVSAETKVADWLVQNDPSLLHRVGPGDDRHSTKSDLPVHTRTLKGHKHEDGTQ
SDSEDPLAKAASAAGVPLEASGEQVRLQRQIKRDPQELLHNQQAFVIEFFDEDTPRKKRS
QSFTHSPSGDPKADKRRGPTPADRDRPSVPAPVQAGGRSSGPQRAGSLKREKTEERLGSP
SPASRTPARPFGSVGRRSRLAQDFMAQCLRESSPAARPSPEKVPPVLPAPLTPRGTSPVG
PPTPPPAPTDPQLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQVFGVLESPE
LSRASSATFRPVIRGDRDESDDGGVAQRMALLQEFASRPLGAAPQVEHQGLPVPGSPGGQ
KWVSRWASLADSYSDPGLTEDGLGRRGGEPEGSLPVRTRRRLPQLPSERADSPAGPESSR
RSGPGPPELGSEQPSRLFGQEELDPDSLSDASGSDGGRGPEPGVEPQDSRRRSPQEGPTW
SRGQRSPRAPGEPTPTSFFIGDQNGDAVLPRKPLAAPGDGEGLGQTAQPSPPARDGVYVS
ANGRMVIQLRPGRSPEPDGPAPAFLRQESFTKEPASGPPAPGKPPHISSHPLLQDLAATR
AARMDFHSQDTHLILKETETALAALEARLLSNSVDAECEGGSTPRLLEDALSGDSDMDTA
STVSLRSGKSGPSPTTHQPLRAQKEMSPSPPAAQDPGGTALGSAHEQSSERQHHPLGPTD
MGCGEPVRRSAIRRGHRPRGSLDWPSEERGPVLAHLPGSDVMASNHETPEATGAGRLGSR
RKPAAPLPSPAAREEQSRSSASSQKGPQALTRSNSLSTPRPTRASRLRRARLGDASDTEA
ADGERGSLGNPEPVGRPAAEQAKKLSRLDILAMPRKRAGSFTGTSDPEAAPARTSFSGRS
VELCCASRKPTMAEARAVARKAANTATTTGPRQPFSRARSGSARYTSNTRRRQQGSDYTS
TSEEEYGSRHGSPKHTRSHTSTATQTPRAGSSSRARDTDDDEEEPDPYGFIVQTAEIAEI
ARLSQTLVKDVAILAQEITEGGCALSTFRAGAGRCSHSLAGASARGPRCRPCLLQLVQRI
PEASLNFQKVPPGSLNSRDFDQNMNDSCEDALANKTRPRNREEVIFDNLMLNPVSQLSQA
IRENTEHLAEKMKILFQNTGRAWEDLEARINAENEVPILKTSNKEISSILKELRRVQKQL
EVINAIVDPSGSLDLLTGNRSLASSAQPGLGKGRVAAQSPPSPASAEALLPALPLRNFPQ
RASCGPPSLPDPTFLPDAERFLI
Download sequence
Identical sequences ENSGGOP00000006360 ENSGGOP00000006360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]