SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006366 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006366
Domain Number 1 Region: 22-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-47
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 374-421
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000235
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006366   Gene: ENSGGOG00000006509   Transcript: ENSGGOT00000006536
Sequence length 426
Comment pep:known_by_projection chromosome:gorGor3.1:7:92777161:92828844:1 gene:ENSGGOG00000006509 transcript:ENSGGOT00000006536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTTAPVTKSGAAKLVKRNFLEALKSNDFGKLKAILIQRQIDVDTVFEVEDENMVLASY
KQGYWLPSYKLKSSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANV
DCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLH
TAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLD
YKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRP
AAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPD
DDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRAIPLLSLPLSLKKYLLLE
PEGIIY
Download sequence
Identical sequences G3QUG4 H2PMV9 Q9Y574
gi|7706379|ref|NP_057200.1| ENSP00000321388 ENSGGOP00000006366 9600.ENSPPYP00000019953 9606.ENSP00000321388 ENSPPYP00000019953 ENSP00000321388 NP_057200.1.87134 NP_057200.1.92137 XP_002818286.1.23681 XP_004045831.1.27298 ENSPPYP00000019953 ENSGGOP00000006366 ENSP00000321388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]