SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006377 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006377
Domain Number 1 Region: 23-316
Classification Level Classification E-value
Superfamily L domain-like 1.09e-56
Family Ngr ectodomain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006377   Gene: ENSGGOG00000006518   Transcript: ENSGGOT00000006547
Sequence length 359
Comment pep:known_by_projection chromosome:gorGor3.1:5:33554122:33558476:1 gene:ENSGGOG00000006518 transcript:ENSGGOT00000006547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRPMLLLSLGLLAGLLPALAACPQNCHCHGDLQHVICDKVGLQKIPKVSEKTKLLNLQR
NNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFD
DLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSE
NALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQ
SFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNN
PWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
Download sequence
Identical sequences G3QUH5 H2QDF2
ENSPTRP00000015965 XP_001170009.4.37143 XP_009431089.2.37143 XP_016787992.1.37143 ENSPTRP00000015965 ENSGGOP00000006377 9598.ENSPTRP00000015965 ENSGGOP00000006377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]