SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006396 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006396
Domain Number 1 Region: 104-283
Classification Level Classification E-value
Superfamily EF-hand 7.89e-51
Family Calmodulin-like 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006396   Gene: ENSGGOG00000006534   Transcript: ENSGGOT00000006566
Sequence length 285
Comment pep:known_by_projection chromosome:gorGor3.1:10:115365140:115383644:-1 gene:ENSGGOG00000006534 transcript:ENSGGOT00000006566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGRV
FRFLGDSSLPSALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRK
ELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDF
VAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAP
REHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Download sequence
Identical sequences A0A2I3RU08 G3QUJ2
9606.ENSP00000420040 gi|21361460|ref|NP_055406.2| ENSGGOP00000006396 ENSGGOP00000006396 ENSP00000359063 ENSP00000420040 NP_055406.2.87134 NP_055406.2.92137 XP_003825554.1.60992 XP_004050045.1.27298 XP_016774669.1.37143 ENSP00000420040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]