SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006412 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006412
Domain Number 1 Region: 145-453
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.6e-84
Family Transglutaminase core 0.000000789
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily E set domains 9.45e-43
Family Transglutaminase N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 473-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.19e-28
Family Transglutaminase, two C-terminal domains 0.0024
Further Details:      
 
Domain Number 4 Region: 587-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.28e-28
Family Transglutaminase, two C-terminal domains 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006412   Gene: ENSGGOG00000006553   Transcript: ENSGGOT00000006582
Sequence length 691
Comment pep:known_by_projection chromosome:gorGor3.1:15:21908311:21932582:-1 gene:ENSGGOG00000006553 transcript:ENSGGOT00000006582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILHFRAPVRAFLPALRKVA
LTAQTGEQPSKIHRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLL
LQVSGRKQHLLGQFTLLFNPWSREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWD
FGQFEGDVIDLSLRLLSEDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQERA
LLNKRRGSVPILRQWLTGQGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGG
RLLIDEYYNEEGLQNGEVQRGRIWIFQTSTECWMTRPALPEGYDGWQILHPSAPNGGGVL
GSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNIST
KGVGSDRCEDITQNYKYPEGSLQEKEVLERVKKEKMEREKDNGIRPPSLETANPLYLLLK
APSSLPLRGDAQISVTLVNHSEQEKAVQLALGVQAVHYNGVLAAKLWRKKLHLTLSANLE
KIITIGLFFSNFERNPPENTFLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQ
YQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFHSVWPENTMCAKFQFTPTHVG
LQRLTVEVDCNMFQNLTNYKSVTVVAPELSA
Download sequence
Identical sequences G3QUK7
ENSGGOP00000006412 XP_004056113.1.27298 ENSGGOP00000006412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]