SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000006438 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000006438
Domain Number 1 Region: 45-298
Classification Level Classification E-value
Superfamily L domain-like 5.27e-41
Family Ngr ectodomain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000006438   Gene: ENSGGOG00000006581   Transcript: ENSGGOT00000006608
Sequence length 371
Comment pep:known_by_projection chromosome:gorGor3.1:3:119894823:119923121:-1 gene:ENSGGOG00000006581 transcript:ENSGGOT00000006608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEDRRGAREALLRLLLPHNRLVSLP
RALGSGFPHLQLLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPSALPKGLAQSPLCR
SLQVLNFSGNCFQEVPASLLELRALQTLSLGGNQLQSIPAEIENLQSLECLYLGGNFIKE
IPPELGNLPSLNYLVLCDNKIQSVPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
SLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLGSASNCPNPK
CGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASV
AARRMQKVLLG
Download sequence
Identical sequences G3QUN2
XP_018879333.1.27298 ENSGGOP00000006438 ENSGGOP00000006438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]